DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and C1S

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001725.1 Gene:C1S / 716 HGNCID:1247 Length:688 Species:Homo sapiens


Alignment Length:389 Identity:98/389 - (25%)
Similarity:149/389 - (38%) Gaps:128/389 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKY-CDE---------------------FNDI 61
            :.|..:||..|..|.|            |.|:.::| |:|                     .|::
Human   361 IPESIENGKVEDPEST------------LFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEV 413

  Fly    62 V------C---CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMA 117
            :      |   |.:|.:           |||::.:              |:||:.|..|.||:..
Human   414 LGPELPKCVPVCGVPRE-----------PFEEKQR--------------IIGGSDADIKNFPWQV 453

  Fly   118 LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNS 182
            ..          |..| .||::::..:||||||.:|.:.      :|..             |..
Human   454 FF----------DNPW-AGGALINEYWVLTAAHVVEGNR------EPTM-------------YVG 488

  Fly   183 TTDDALVQDFRVV--------NYVVHPGYDTEDEEQG---FKNDIALVELDRKAEFNDHVAAVCL 236
            :|.   ||..|:.        :..:|||:...:..:|   |.||||||.|....:....|:.:||
Human   489 STS---VQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICL 550

  Fly   237 PPDSGN----DVQQVTAAGWGFT-----ADGVKSSHLLKVNLQRFSDEVCQKRLRFS---IDTRT 289
            |..|.:    |......:|||.|     |..:|::.|....|::..:...:|....:   :.|..
Human   551 PGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPN 615

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..|||..... |:|.|||||...||.|.........|:||:|..||:.||   ||:|..|.|||
Human   616 MICAGGEKGM-DSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGL---YTRVKNYVDWI 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/275 (29%)
Tryp_SPc 102..353 CDD:214473 78/273 (29%)
C1SNP_001725.1 CUB 18..129 CDD:238001
FXa_inhibition 143..171 CDD:405372
CUB 175..287 CDD:395345
CCP 294..355 CDD:153056
Sushi 359..421 CDD:395037 12/71 (17%)
Tryp_SPc 438..678 CDD:238113 80/275 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.