DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:349 Identity:94/349 - (26%)
Similarity:146/349 - (41%) Gaps:86/349 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DNGTGECKELTPSDCPVIFYNQ--HLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQC 86
            |:|:....:|..|...|..|.:  |......|.......|.|      ..||..:.|:|      
Human   240 DSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIAC------GVNLNSSRQSR------ 292

  Fly    87 KQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHC 151
                           ||||..|....:|:.  :..|..|...      ||||::.|::::|||||
Human   293 ---------------IVGGESALPGAWPWQ--VSLHVQNVHV------CGGSIITPEWIVTAAHC 334

  Fly   152 LETDESKAERLDPNFDSPKF--VVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN 214
            :|      :.|:..:....|  ::|...:.|.:        .::|...:.||.||::.:    .|
Human   335 VE------KPLNNPWHWTAFAGILRQSFMFYGA--------GYQVEKVISHPNYDSKTK----NN 381

  Fly   215 DIALVELDRKAEFNDHVAAVCLP-------PDSGNDVQQVTAAGWGFTADGVKSSHLLK------ 266
            ||||::|.:...|||.|..||||       |:     |....:|||.|.:..|:|.:|.      
Human   382 DIALMKLQKPLTFNDLVKPVCLPNPGMMLQPE-----QLCWISGWGATEEKGKTSEVLNAAKVLL 441

  Fly   267 VNLQRFSDEVCQKRLRF-SIDTRTQFCAGSMSSQADTCNGDSGGPIFV-QHPLYPCLKQVIGIVS 329
            :..||     |..|..: ::.|....|||.:....|:|.||||||:.. ::.::    .:||..|
Human   442 IETQR-----CNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIW----WLIGDTS 497

  Fly   330 YGLVCGSQGLPSVYTKVHLYTDWI 353
            :|..|.....|.||..|.::||||
Human   498 WGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/269 (30%)
Tryp_SPc 102..353 CDD:214473 78/267 (29%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 10/48 (21%)
Tryp_SPc 292..521 CDD:214473 79/289 (27%)
Tryp_SPc 293..524 CDD:238113 80/269 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.