DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss41

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:293 Identity:94/293 - (32%)
Similarity:143/293 - (48%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 CKQYNEVRSACQSTPFIVGGTKASGKEFPFMA---LIGTHRPNKSKSDINWDCGGSVVHPKFVLT 147
            |.:.|:.||.      ||||.::....:|:.|   |..:||           ||||::..::|||
Mouse    74 CGRRNDTRSR------IVGGIESMQGRWPWQASLRLKKSHR-----------CGGSLLSRRWVLT 121

  Fly   148 AAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST--TDDALVQDFRVVNYVVHPGYDTEDEEQ 210
            ||||..      :.|||.    |:.|:||:|....:  ...|....:||.:.:|    ::||:.:
Mouse   122 AAHCFR------KYLDPE----KWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIV----NSEDKLK 172

  Fly   211 GFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ----VTAAGWGFTADGVK----SSHLLKV 267
              .:|:||:.|.....:|..:..||:.|.:.....|    ||  |||...:.:|    ..||.:|
Mouse   173 --SHDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVT--GWGVLQEDLKPLPPPYHLREV 233

  Fly   268 NLQRFSDEVCQKRLR-FSID---TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPC----LKQV 324
            .:...::..||:... ||:.   |:..||||:....||||:||||||:.       |    |...
Mouse   234 QVSILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLV-------CNMDGLWYQ 291

  Fly   325 IGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            |||||:|:.||...||.:||.|..|.:|||:::
Mouse   292 IGIVSWGIGCGRPNLPGIYTNVSHYYNWIETMM 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 90/274 (33%)
Tryp_SPc 102..353 CDD:214473 87/271 (32%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 88/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.