DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss22

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:125/276 - (45%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||..:...::|::..|   |:|.           |.||::..::|:|||||.::         
Mouse   108 IVGGEDSMDAQWPWIVSILKNGSHH-----------CAGSLLTNRWVVTAAHCFKS--------- 152

  Fly   164 PNFDSPK-FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
             |.|.|. |.|.||.....|....:  |...:...:.||.|..   ::|...|||||.|:...:|
Mouse   153 -NMDKPSLFSVLLGAWKLGSPGPRS--QKVGIAWVLPHPRYSW---KEGTHADIALVRLEHSIQF 211

  Fly   228 NDHVAAVCLPPDSGNDVQQVT---AAGWGFTADGVKSSH---LLKVNLQRFSDEVCQKRLRF--- 283
            ::.:..:|| |||...:...|   .||||...|||...|   |.|:.:.....|:| |.|.:   
Mouse   212 SERILPICL-PDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELC-KSLYWRGA 274

  Fly   284 --SIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ---HPLYPCLKQVIGIVSYGLVCGSQGLPSVY 343
              ...|....|||.:..:.|.|.||||||:..|   |.|      :.||:|:|..|..:..|.||
Mouse   275 GQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWL------LTGIISWGEGCAERNRPGVY 333

  Fly   344 TKVHLYTDWIESIVWG 359
            |.:..:..|::.||.|
Mouse   334 TSLLAHRSWVQRIVQG 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/271 (30%)
Tryp_SPc 102..353 CDD:214473 81/268 (30%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 82/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.