DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC683849

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:263 Identity:79/263 - (30%)
Similarity:111/263 - (42%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||........|:...:  |.|           .||||:::.::|::||||.::          
  Rat    24 IVGGYTCQENSVPYQVSLNSGYH-----------FCGGSLINDQWVVSAAHCYKS---------- 67

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                 :..|||||  :|....:...|.......:.||.:|    .:...|||.|::|....:.|.
  Rat    68 -----RIQVRLGE--HNINVLEGNEQFVNAAKIIKHPNFD----RKTLNNDIMLIKLSSPVKLNA 121

  Fly   230 HVAAVCLPPDSGNDVQQVTAAGWGFTAD-GVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFC 292
            .||.|.||........|...:|||.|.. ||....||: ::........|:......| |....|
  Rat   122 RVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEASYPGKI-TDNMVC 185

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            ||.:....|:|.||||||:.       |..::.||||:|..|.....|.|||||..|.||||..:
  Rat   186 AGFLEGGKDSCQGDSGGPVV-------CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIEDTI 243

  Fly   358 WGN 360
            ..|
  Rat   244 AAN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/257 (30%)
Tryp_SPc 102..353 CDD:214473 75/254 (30%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 75/254 (30%)
Tryp_SPc 24..242 CDD:238113 78/257 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.