DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss55

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:268 Identity:80/268 - (29%)
Similarity:121/268 - (45%) Gaps:51/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |:||.:|...|||:...|       .::|.:: ||||::...::||.|||..:.|     |.|. 
  Rat    35 IIGGQEAEVGEFPWQVSI-------QENDHHF-CGGSILSEWWILTVAHCFYSQE-----LSPT- 85

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
               :..||:|..|..::.     .:.:|.|.:.|..:    :.....|||||:.|.....||:..
  Rat    86 ---ELTVRVGTNDLTTSP-----MELQVTNIIRHKDF----KRHSMDNDIALLLLANPLTFNEQT 138

  Fly   232 AAVCLP----PDSGNDVQQVTAAGWGFTADGVKSS---HLLKVNLQRFSDEVCQKRLRFSIDTRT 289
            ..:|:|    |.|.   |:...||||.|....|.|   .|:||.::....:.|.:  .|...|..
  Rat   139 VPICMPLQPTPPSW---QECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECLQ--LFPSLTTN 198

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ------VIGIVSYGLVCGSQGLPSVYTKVHL 348
            ..||...:...|.|.||||||:.       |.::      .:||:|:|..||.:|.|.:||.:..
  Rat   199 MLCASYGNESFDACQGDSGGPLV-------CNQESDGRWYQVGIISWGKSCGQKGSPGIYTVLAN 256

  Fly   349 YTDWIESI 356
            |..|||.|
  Rat   257 YILWIEKI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/266 (30%)
Tryp_SPc 102..353 CDD:214473 76/263 (29%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 79/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.