DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and f9b

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001035400.1 Gene:f9b / 678552 ZFINID:ZDB-GENE-060421-7346 Length:507 Species:Danio rerio


Alignment Length:421 Identity:102/421 - (24%)
Similarity:162/421 - (38%) Gaps:114/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKE---LTPSDCPVIFYNQHLIGAEVKYC-------------DEFNDIVC-CP----I 66
            |.|| |:|::   .....||..|..::......|.|             |:....|| |.    :
Zfish    97 CQNG-GKCEDGMNTYTCWCPARFSGKNCELEMAKQCHVNNGGCMHFCIVDKIYGAVCDCAEGYRL 160

  Fly    67 PLDHQNLKPAEQ---------------TRPFEK-------------QCKQYNEVRSA-------- 95
            .:|.::.:|..|               :|..|.             ...:||...|:        
Zfish   161 AVDGRSCEPRGQYPCGRLGKIIAQTLNSRALESTETVNQNQTISHINGTEYNTTESSPTDLSEMN 225

  Fly    96 CQSTP------------------------FIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCG 136
            ..|||                        .||||.:|...|.|:. ::...:.||...     ||
Zfish   226 STSTPRNSLQNVSSSPILTNINNTTNNKYRIVGGDEAIPGEIPWQ-VVFLEKVNKIVF-----CG 284

  Fly   137 GSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHP 201
            ||::..::|:|||||:|..:.            .|.:|:||.|.:..  :....|..:..|.:||
Zfish   285 GSLLSEEWVITAAHCVEGKQG------------SFFIRVGEHDVSKM--EGTESDHGIEEYHIHP 335

  Fly   202 GYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGND-----VQQVTAAGWG-FTADGVK 260
            .|::  :...:.:||||::|.:.....|:...:||......:     .:....:||| ....|::
Zfish   336 RYNS--QRSLYNHDIALLKLKKPVILFDYAVPICLGSKDFTENLLQSAENSLVSGWGRLRYGGIE 398

  Fly   261 SSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI 325
            |:.|.||.|.......|:.....|| :|..||||..:.:.|.|.||||||...:   |.....:.
Zfish   399 SNVLQKVELPYVDRIKCKGSSTDSI-SRFMFCAGYSTVRKDACQGDSGGPHATR---YKDTWFLT 459

  Fly   326 GIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            ||||:|..|..:|...:||::..|..||.:|
Zfish   460 GIVSWGEECAKEGKYGIYTRISKYMAWITNI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/259 (29%)
Tryp_SPc 102..353 CDD:214473 74/256 (29%)
f9bNP_001035400.1 GLA 23..86 CDD:214503
EGF_CA 88..124 CDD:238011 8/27 (30%)
FXa_inhibition 131..167 CDD:291342 6/35 (17%)
Tryp_SPc 255..487 CDD:214473 74/257 (29%)
Tryp_SPc 256..490 CDD:238113 76/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.