DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:292 Identity:93/292 - (31%)
Similarity:126/292 - (43%) Gaps:74/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NEVRSACQSTP--------FIVGGTKASGKEFPF---MALIGTHRPNKSKSDINWDCGGSVVHPK 143
            |.:...|.:.|        .|:|||:|...::|:   :.|...|.           |||:::...
  Rat   166 NVLTQECGARPDLITLSEERIIGGTQAETGDWPWQVSLQLNNVHH-----------CGGTLISNL 219

  Fly   144 FVLTAAHCLETDESKAERLDPNFD----SPKFVVR----LGELDYNSTTDDALVQDFRVVNYVVH 200
            :|||||||..: .|..::....|.    ||:..||    |...:|||.|.|              
  Rat   220 WVLTAAHCFRS-YSNPQQWTATFGVSTISPRLRVRVRAILAHAEYNSITRD-------------- 269

  Fly   201 PGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP-------PDSGNDVQQVTAAGWG-FTAD 257
                         ||||:|:|||...|..::..||||       |||   |..||  ||| .|..
  Rat   270 -------------NDIAVVQLDRPVTFTRNIHRVCLPAATQNIIPDS---VAYVT--GWGSLTYG 316

  Fly   258 GVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT-QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCL 321
            |...::|.:..::..|.|||.:...:...... ..|||..|...|.|.||||||: ||..... |
  Rat   317 GNTVTNLQQGEVRIVSSEVCNEPAGYGGSVLPGMLCAGVRSGAVDACQGDSGGPL-VQEDTRR-L 379

  Fly   322 KQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..|:||||:|..||....|.|||:|..|.:||
  Rat   380 WFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 90/272 (33%)
Tryp_SPc 102..353 CDD:214473 88/270 (33%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 90/272 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.