DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and zgc:123217

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:289 Identity:70/289 - (24%)
Similarity:122/289 - (42%) Gaps:63/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CQSTPF---IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDES 157
            |...|.   |||||.|....:|:.  :..|..|:.      .|||:::|.::|:|||||:     
Zfish    28 CGVAPLNTRIVGGTDAPAGSWPWQ--VSIHYNNRH------ICGGTLIHSQWVMTAAHCI----- 79

  Fly   158 KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
                ::.|.:  .:.:.||....:::..:.......:.:.:.||.::    .....|||:|::|.
Zfish    80 ----INTNIN--VWTLYLGRQTQSTSVANPNEVKVGIQSIIDHPSFN----NSLLNNDISLMKLS 134

  Fly   223 RKAEFNDHVAAVCLPPDSGNDV----QQVTAAGWGFTADGVKSSHLL-------KVNLQRFSDEV 276
            :...|:.::..:||.  :.|.:    ....|.|||    .:.....|       :|.:...::.:
Zfish   135 QPVNFSLYIRPICLA--ANNSIFYNGTSCWATGWG----NIGKDQALPAPQTLQQVQIPVVANSL 193

  Fly   277 CQKRLRFSIDTRT----QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI----GIVSYGLV 333
            |..... |::..|    ..|||  .:...||.||||||       :.|.:..:    ||.|||..
Zfish   194 CSTEYE-SVNNATITPQMICAG--KANKGTCQGDSGGP-------FQCKQGSVWIQAGITSYGTS 248

  Fly   334 --CGSQGLPSVYTKVHLYTDWIESIVWGN 360
              |.....|.||::|..:..||:..|.|:
Zfish   249 AGCAVGAYPDVYSRVSEFQSWIKMNVQGS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 66/274 (24%)
Tryp_SPc 102..353 CDD:214473 64/271 (24%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 64/272 (24%)
Tryp_SPc 37..273 CDD:238113 66/274 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.