DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and c1s

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:363 Identity:108/363 - (29%)
Similarity:156/363 - (42%) Gaps:83/363 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CKELTPSDCPVIFYNQHLIGAEVKY-C-DEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQY--- 89
            |.|..|.|...:|.|....|:|:.| | ||:..:..           ||.:...:  .|..|   
 Frog   359 CGEPDPIDNGNVFSNTTTYGSEITYNCSDEYYALTL-----------PAGEDGTY--SCSSYGYW 410

  Fly    90 -----NEVRSACQSTPF-----------IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGS 138
                 |:....|  ||.           |.|||:|...:||:|...         :||... |||
 Frog   411 VNSRGNKELPIC--TPVCGVHQSDKSGRIFGGTRAKPGQFPWMIQF---------TDIELG-GGS 463

  Fly   139 VVHPKFVLTAAHCLETDESKAERLDPNF--DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHP 201
            ::..::||||||.:.      :::.|..  ...||        :.:|...:..:..:....::||
 Frog   464 LISDRWVLTAAHVVN------KKIFPTMFGGVMKF--------FPNTNLQSQEKRLQAKKIIIHP 514

  Fly   202 GY-DTEDEE--QGFKNDIALVELDRKAEFNDHVAAVCLP----PDSGNDVQQVTAAGWGFTADGV 259
            .| |.||.|  ..|.||||||:|.:|.:....::.:|||    ....|:|  .|.||||.|....
 Frog   515 LYQDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAPVVNEV--ATIAGWGKTEKRE 577

  Fly   260 KSSHLLKVNLQRFSDEVCQK----RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPC 320
            .:.:|...::...|.:.|:|    :..|   |....||||...: |:||||||||:....|....
 Frog   578 SAVNLQFASISLSSMDKCKKATGGKGYF---TPNMLCAGSDVGK-DSCNGDSGGPLMFTDPQDSS 638

  Fly   321 LKQVIGIVSYG-LVCGSQGLPSVYTKVHLYTDWIESIV 357
            ...:.||||:| ..||:.||   ||||..|.||||..:
 Frog   639 KMYMAGIVSWGPRDCGTYGL---YTKVDNYLDWIEETI 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 88/267 (33%)
Tryp_SPc 102..353 CDD:214473 85/264 (32%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 20/91 (22%)
Tryp_SPc 436..669 CDD:214473 85/265 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.