DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG34458

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:300 Identity:74/300 - (24%)
Similarity:125/300 - (41%) Gaps:65/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPF---MALIGTH 122
            |:...:...|.::..||::|                     |:||..|:..:||.   :.|.|.|
  Fly    12 ILLLAVTFVHSDMDVAEESR---------------------IIGGQFAAPGQFPHQVSLQLNGRH 55

  Fly   123 RPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDA 187
            .           ||||::....::|||||         .:..|....|.:|...:|...:.    
  Fly    56 H-----------CGGSLISDTMIVTAAHC---------TMGQNPGQMKAIVGTNDLSAGNG---- 96

  Fly   188 LVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTA--A 250
              |.|.:..:::||.|:.:.::    .|::|::|.........|..:.|.....|......|  :
  Fly    97 --QTFNIAQFIIHPRYNPQSQD----FDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMIS 155

  Fly   251 GWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ 314
            |:|.....::..:.|| ..:|.:|.:.|..:....:..| ..|||..|.|..:|.||||||:.|.
  Fly   156 GFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPGLTDR-MVCAGHPSGQVSSCQGDSGGPLTVD 219

  Fly   315 HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ..|:       |:||:|..||::|.|::||.|.....||:
  Fly   220 GKLF-------GVVSWGFGCGAKGRPAMYTYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 69/258 (27%)
Tryp_SPc 102..353 CDD:214473 67/256 (26%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 68/278 (24%)
Tryp_SPc 32..254 CDD:238113 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.