DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG34436

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster


Alignment Length:261 Identity:66/261 - (25%)
Similarity:111/261 - (42%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGEL 178
            |:|||:  ..|||:       |.|:::|..||:|:|.|:             |:..:.:||||:|
  Fly    42 PWMALV--LLPNKT-------CSGALIHKYFVITSASCV-------------FNQERAIVRLGQL 84

  Fly   179 --------DYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
                    .|:|       .|:.|.:..:|..|    |:..|::||||:||.....:..|:..:|
  Fly    85 SIKQEHIVSYSS-------DDYHVQSAYIHRFY----EKSNFEHDIALLELQNDVLYKAHIRPIC 138

  Fly   236 LPPDSGN-DVQ---QVTAAGWG----FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC 292
            |..|..: |.|   :.....||    :.....|:|     .::..|...|:...:. ....:..|
  Fly   139 LWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKTS-----KIKHISQVKCENAFKL-YPQNSHIC 197

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI-GIVSYGLVCGSQGLPSVYTKVHLYTDWIESI 356
            ||..:.....   ::|.|:|.:...|..::..: ||.|||     :....:||.|..|.|||..:
  Fly   198 AGYKNKSKCV---ETGSPLFKKIRYYTKIRYTLFGIQSYG-----ESRTCLYTDVTKYIDWIMGV 254

  Fly   357 V 357
            :
  Fly   255 I 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 66/258 (26%)
Tryp_SPc 102..353 CDD:214473 64/255 (25%)
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 65/256 (25%)
Tryp_SPc 40..251 CDD:214473 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.