DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG34290

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:295 Identity:74/295 - (25%)
Similarity:125/295 - (42%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VRSACQSTPFIVGG-----TKASGKEFPFMALIGTHRPNKSKSDINWD--CGGSVVHPKFVLTAA 149
            |..:|.:.| ||||     ..:|..::|||..:.......:.:.:::.  ||||::..:::|:||
  Fly    25 VLESCHAVP-IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSLISDRWILSAA 88

  Fly   150 HCLETDESKAERLDPNFDSPKFVVRLGELD-YNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK 213
            ||:   ..|.......|...:.:..:|:|. |.          ...|.|:..       :...|:
  Fly    89 HCV---WRKNIHYIAAFIGYENIENIGQLQPYG----------LESVEYIYF-------QPSNFR 133

  Fly   214 NDIALVELDRK--AEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEV 276
            |||||:.:.|:  ::|.:.:....|||.             |...|..:|..::.......:.. 
  Fly   134 NDIALLYMKRRYWSDFGNGLQYAQLPPH-------------GMKPDQNESCRIIGYGATHHAGP- 184

  Fly   277 CQKRLRFSIDTR---TQFCAG----------------SMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            ||||| |..:.|   .|.|..                ::.:..|:|.||||||:..   .|....
  Fly   185 CQKRL-FEAEVRVIDNQKCRDIIGHIWAPQNGANTVCALGNNQDSCQGDSGGPLIC---TYGGKD 245

  Fly   323 QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .:.|:||:||.||..|:||:||....|.||::.::
  Fly   246 YIYGLVSHGLTCGIPGMPSIYTVTRPYYDWVQLLM 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/282 (25%)
Tryp_SPc 102..353 CDD:214473 70/279 (25%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 71/280 (25%)
Tryp_SPc 34..276 CDD:214473 70/279 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.