powered by:
Protein Alignment CG3700 and AgaP_AGAP012035
DIOPT Version :9
Sequence 1: | NP_611736.1 |
Gene: | CG3700 / 37640 |
FlyBaseID: | FBgn0034796 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001689264.1 |
Gene: | AgaP_AGAP012035 / 5668016 |
VectorBaseID: | AGAP012035 |
Length: | 197 |
Species: | Anopheles gambiae |
Alignment Length: | 75 |
Identity: | 19/75 - (25%) |
Similarity: | 32/75 - (42%) |
Gaps: | 19/75 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 ILLLIASVSV----VTEYC--DNGT-------GECKELTPSDCPVIFYN--QHLIGAEVKYC--D 56
::|.:..|:. |.:.| .||: |||.::.......:.|: ...|.|.::.| |
Mosquito 21 LMLFLVGVAFGQRRVNQACILANGSSGRCIRIGECSKIVELTTRNVLYSWETQQIRAVLRACESD 85
Fly 57 EFND--IVCC 64
|.:. ||||
Mosquito 86 ESSSDPIVCC 95
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3700 | NP_611736.1 |
Tryp_SPc |
102..356 |
CDD:238113 |
|
Tryp_SPc |
102..353 |
CDD:214473 |
|
AgaP_AGAP012035 | XP_001689264.1 |
CLIP |
39..95 |
CDD:288855 |
14/55 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.