DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012035

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001689264.1 Gene:AgaP_AGAP012035 / 5668016 VectorBaseID:AGAP012035 Length:197 Species:Anopheles gambiae


Alignment Length:75 Identity:19/75 - (25%)
Similarity:32/75 - (42%) Gaps:19/75 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLIASVSV----VTEYC--DNGT-------GECKELTPSDCPVIFYN--QHLIGAEVKYC--D 56
            ::|.:..|:.    |.:.|  .||:       |||.::.......:.|:  ...|.|.::.|  |
Mosquito    21 LMLFLVGVAFGQRRVNQACILANGSSGRCIRIGECSKIVELTTRNVLYSWETQQIRAVLRACESD 85

  Fly    57 EFND--IVCC 64
            |.:.  ||||
Mosquito    86 ESSSDPIVCC 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113
Tryp_SPc 102..353 CDD:214473
AgaP_AGAP012035XP_001689264.1 CLIP 39..95 CDD:288855 14/55 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.