DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011432

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001689064.1 Gene:AgaP_AGAP011432 / 5667979 VectorBaseID:AGAP011432 Length:212 Species:Anopheles gambiae


Alignment Length:143 Identity:32/143 - (22%)
Similarity:58/143 - (40%) Gaps:54/143 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 KSKSDINW--------DCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNS 182
            ||:..:.|        |||.:::..:::||||.|:::.:.          .||||:       :.
Mosquito    73 KSRFGLLWKESDSPSNDCGATLIDYQYLLTAASCVKSSKG----------YPKFVI-------SE 120

  Fly   183 TTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH--VAAVCLPPDSGNDVQ 245
            :.:.|.:.|     ..|.|.|.....|    :|:||:::   |::.:|  ...|||         
Mosquito   121 SGERAAISD-----VYVSPSYRAGRPE----SDLALLKI---AKYANHQVYRPVCL--------- 164

  Fly   246 QVTAAGWGFTADG 258
                  |...:||
Mosquito   165 ------WDRRSDG 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 32/143 (22%)
Tryp_SPc 102..353 CDD:214473 32/143 (22%)
AgaP_AGAP011432XP_001689064.1 Tryp_SPc <8..39 CDD:304450
Tryp_SPc 90..>170 CDD:304450 26/123 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.