DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012021

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001689269.1 Gene:AgaP_AGAP012021 / 5667919 VectorBaseID:AGAP012021 Length:296 Species:Anopheles gambiae


Alignment Length:292 Identity:68/292 - (23%)
Similarity:109/292 - (37%) Gaps:94/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EYCDNGTGECKELTPSDCPVIFYNQHL-IGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEK 84
            ||.|...|.| ...|| ||.|  |..| ...:|.:|...| :||||.......:...|..   ..
Mosquito    56 EYADGTKGTC-TAEPS-CPDI--NARLQNNQQVIFCGNRN-VVCCPNKATDPRMMAIENE---FN 112

  Fly    85 QCKQ-YNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDIN-----WDCGGSVVHPK 143
            ||:: |..:|                           |.:.|.|...:|     :.|.|.::..:
Mosquito   113 QCEERYRHLR---------------------------TDQQNGSSHAVNDRNTTYGCFGYLISTR 150

  Fly   144 FVLTAAHCLETDESKAERLD-PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTED 207
            .|:.:|.||      :||.| ||      :|::|.:|   :.|::.|.....|  ::||.|..|.
Mosquito   151 GVVASASCL------SERADLPN------IVQIGGID---SLDNSRVVPIEKV--IIHPDYKKET 198

  Fly   208 EEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRF 272
            .|    ::||:|:|:...:.:::|...||       .|.:|.:........:..||   :..:||
Mosquito   199 LE----HNIAIVKLESTVDPSENVFPTCL-------WQNITHSPTHLKGPKICFSH---IGNKRF 249

  Fly   273 SD--------------------EVCQKRLRFS 284
            .|                    |.|..|.|::
Mosquito   250 YDIYQMYQNDCETYLNRSMADSEACMFRKRWT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 44/209 (21%)
Tryp_SPc 102..353 CDD:214473 44/209 (21%)
AgaP_AGAP012021XP_001689269.1 Tryp_SPc 132..>223 CDD:304450 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.