DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and KLK10

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:254 Identity:72/254 - (28%)
Similarity:103/254 - (40%) Gaps:68/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV-----Q 190
            :::.|.|.:|...:|||||||               .:.....|:|        ||.|:     |
Human    67 LSFHCAGVLVDQSWVLTAAHC---------------GNKPLWARVG--------DDHLLLLQGEQ 108

  Fly   191 DFRVVNYVVHPGYDTEDEEQGF---------KNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ 246
            ..|....||||.|     .||.         ::|:.|::|.|.......|.|:.||........|
Human   109 LRRTTRSVVHPKY-----HQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQ 168

  Fly   247 VTAAGWGFTADGVKSSHLLKVN-------LQRFSDEVCQKRLRF--SIDTRTQFCAGSMSSQADT 302
            ...||||.||     :..:|.|       :...|.:.|:.   |  .:.|....|||....| |.
Human   169 CQVAGWGTTA-----ARRVKYNKGLTCSSITILSPKECEV---FYPGVVTNNMICAGLDRGQ-DP 224

  Fly   303 CNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTKVHLYTDWIESIVWGN 360
            |..|||||:.       |.:.:.||:|:|:. |||...|:|||::..|..||..::..|
Human   225 CQSDSGGPLV-------CDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/248 (29%)
Tryp_SPc 102..353 CDD:214473 69/245 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 71/248 (29%)
Tryp_SPc 49..269 CDD:214473 69/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.