DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TMPRSS15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011527956.1 Gene:TMPRSS15 / 5651 HGNCID:9490 Length:1064 Species:Homo sapiens


Alignment Length:400 Identity:102/400 - (25%)
Similarity:169/400 - (42%) Gaps:112/400 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YCDNGTGECKELTPSDCPVIFYN----------------QHLIGAEVKYCDEFNDIVCCPIPLDH 70
            :|::|:.|      :|| |.|:|                .|...|| .:..:.::.||..:.|..
Human   712 HCEDGSDE------ADC-VRFFNGTTNNNGLVRFRIQSIWHTACAE-NWTTQISNDVCQLLGLGS 768

  Fly    71 QN-LKPAEQT--RPFEK---------------QCKQYNEVRSACQS------------TPFIVGG 105
            .| .||...|  .||.|               ||.|.:.:|..|..            ||.||||
Human   769 GNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQDITPKIVGG 833

  Fly   106 TKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL---ETDESK-----AERL 162
            :.|....:|:  ::|.:...:..      ||.|:|...::::||||:   ..:.||     ...:
Human   834 SNAKEGAWPW--VVGLYYGGRLL------CGASLVSSDWLVSAAHCVYGRNLEPSKWTAILGLHM 890

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
            ..|..||:.|.||                  :...|::|.|:...::    ||||::.|:.|..:
Human   891 KSNLTSPQTVPRL------------------IDEIVINPHYNRRRKD----NDIAMMHLEFKVNY 933

  Fly   228 NDHVAAVCLPPDSGNDV----QQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRL-RFSID 286
            .|::..:|||.:  |.|    :..:.||||... .|..::.|.:.::...|:|.||::: .::| 
Human   934 TDYIQPICLPEE--NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNI- 995

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVH 347
            |....|||......|:|.||||||:.       |.:.    :.|:.|:|..|.....|.||.:|.
Human   996 TENMICAGYEEGGIDSCQGDSGGPLM-------CQENNRWFLAGVTSFGYKCALPNRPGVYARVS 1053

  Fly   348 LYTDWIESIV 357
            .:|:||:|.:
Human  1054 RFTEWIQSFL 1063

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/271 (27%)
Tryp_SPc 102..353 CDD:214473 71/268 (26%)
TMPRSS15XP_011527956.1 SEA 53..195 CDD:214554
LDLa 229..263 CDD:238060
CUB 270..376 CDD:278839
MAM 387..547 CDD:214533
MAM 392..547 CDD:99706
CUB 569..676 CDD:278839
LDLa 688..722 CDD:238060 3/15 (20%)
SR 723..816 CDD:214555 21/93 (23%)
Tryp_SPc 829..1059 CDD:214473 71/269 (26%)
Tryp_SPc 830..1061 CDD:238113 73/270 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.