DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and MASP1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:437 Identity:111/437 - (25%)
Similarity:156/437 - (35%) Gaps:131/437 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ECKEL--------TPSDCPVIFYNQHLIGAEVKY--------CDEF-----------NDIVCC-- 64
            ||.||        .||.....|.:|.|:..:..|        .|.|           |.|..|  
Human   307 ECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKI 371

  Fly    65 -----PIPLDH--------QNLKPAEQ------TRPFEK-------------------------- 84
                 |..|:|        .||...:.      ..|:.|                          
Human   372 VDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSL 436

  Fly    85 -----QCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKF 144
                 :|.|.:  ||.......|:||..|....||:.|||.....::..:| .|...|:::...:
Human   437 PTCLPECGQPS--RSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPND-KWFGSGALLSASW 498

  Fly   145 VLTAAHCLETDESKAERLDPN---FDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTE 206
            :|||||.|     :::|.|..   .......|.||   .:...|.:...:......|:||.::. 
Human   499 ILTAAHVL-----RSQRRDTTVIPVSKEHVTVYLG---LHDVRDKSGAVNSSAARVVLHPDFNI- 554

  Fly   207 DEEQGFKNDIALVELDRKAEFNDHVAAVCLP---PDSGNDVQQVTAAGWGFTADGVKSSHLLKVN 268
               |.:.:|||||:|........||..||||   |:..........||||.:...|....::...
Human   555 ---QNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSG 616

  Fly   269 LQRFSDEVCQKRL-----------------RFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHP 316
            .:..||.:...:|                 .:|: |...||||......|||.||||| .||   
Human   617 TRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSV-TENMFCAGYYEGGKDTCLGDSGG-AFV--- 676

  Fly   317 LYPCLKQ---VIGIVSYG--LVCGSQGLPSVYTKVHLYTDWIESIVW 358
            ::..|.|   |.|:||:|  ..|||:.:..|||||..|.||    ||
Human   677 IFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDW----VW 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/281 (30%)
Tryp_SPc 102..353 CDD:214473 82/278 (29%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512 13/60 (22%)
CCP 374..439 CDD:153056 7/64 (11%)
Tryp_SPc 456..718 CDD:214473 83/283 (29%)
Tryp_SPc 457..718 CDD:238113 83/282 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.