DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and PROC

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:384 Identity:107/384 - (27%)
Similarity:161/384 - (41%) Gaps:86/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YCDNGTGECKEL--------------TPSDCP-------VIFYNQHL-IGAEVKYCDE---FNDI 61
            :|..|.||...|              |.:.||       |.|.|..| .|....||.|   :...
Human   211 FCQRGEGERWMLAGGGAGLGPGWGRGTSTSCPRPPLPAEVSFLNCSLDNGGCTHYCLEEVGWRRC 275

  Fly    62 VCCP---IPLDHQNLKPAEQ---TRPFEKQCKQYNEVR-----SACQSTPFIVGGTKASGKEFPF 115
            .|.|   :..|.....||.:   .||:::..|:.:.::     ...|..|.::.|......:.|:
Human   276 SCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW 340

  Fly   116 MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDY 180
            ..::   ..:|.|    ..||..::||.:|||||||:  ||||           |.:|||||.|.
Human   341 QVVL---LDSKKK----LACGAVLIHPSWVLTAAHCM--DESK-----------KLLVRLGEYDL 385

  Fly   181 NSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG---- 241
            .......|..|.:.|  .|||.|.....:    |||||:.|.:.|..:..:..:|| ||||    
Human   386 RRWEKWELDLDIKEV--FVHPNYSKSTTD----NDIALLHLAQPATLSQTIVPICL-PDSGLAER 443

  Fly   242 --NDV-QQVTAAGWGFTADGVKSS--------HLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGS 295
              |.. |:....|||:.:...|.:        :.:|:.:...::  |.: :..::.:....|||.
Human   444 ELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNE--CSE-VMSNMVSENMLCAGI 505

  Fly   296 MSSQADTCNGDSGGPIFVQ-HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            :..:.|.|.||||||:... |..:    .::|:||:|..||......|||||..|.|||
Human   506 LGDRQDACEGDSGGPMVASFHGTW----FLVGLVSWGEGCGLLHNYGVYTKVSRYLDWI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/268 (30%)
Tryp_SPc 102..353 CDD:214473 79/266 (30%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011 0/1 (0%)
FXa_inhibition 255..290 CDD:317114 8/34 (24%)
Tryp_SPc 328..563 CDD:238113 81/267 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.