DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and LOC562139

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001075159.1 Gene:LOC562139 / 562139 -ID:- Length:263 Species:Danio rerio


Alignment Length:272 Identity:80/272 - (29%)
Similarity:119/272 - (43%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI----GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            ||.|.:|....:|:...:    |.|           .||||:::..:|:|||||           
Zfish    34 IVNGEEAVPHSWPWQVSLQDSTGFH-----------FCGGSLINEWWVVTAAHC----------- 76

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
              |..:...|: |||.|.:|..:.  :|...|.....||.::...    ..|||.|::|...|:.
Zfish    77 --NVRTSHRVI-LGEHDRSSNAEP--IQTMTVGKVFKHPNFNMFT----INNDILLIKLATPAKI 132

  Fly   228 NDHVAAVCLPPDSGN---DVQQVTAAGWGFTADGVKSSHLL--KVNLQRFSDEVCQKRLRFSIDT 287
            |.||:.|||...:.|   .::.|| :|||.|......:..|  :..|...::|.| ||...:..|
Zfish   133 NTHVSPVCLAETNDNFPGGMKCVT-SGWGLTKHNAPDTPALLQQAALPLLTNEDC-KRFWGNKIT 195

  Fly   288 RTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHL 348
            ....|||  :|.|.:|.||||||:.       |.|.    ::||||:|....|...|.||.:|..
Zfish   196 DLMVCAG--ASGASSCMGDSGGPLV-------CQKDGVWTLVGIVSWGSSVCSTSSPGVYARVTK 251

  Fly   349 YTDWIESIVWGN 360
            ...|::..:..|
Zfish   252 LRAWVDQTITAN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/266 (30%)
Tryp_SPc 102..353 CDD:214473 78/263 (30%)
LOC562139NP_001075159.1 Tryp_SPc 33..256 CDD:214473 78/263 (30%)
Tryp_SPc 34..259 CDD:238113 79/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.