DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and zgc:100868

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:331 Identity:90/331 - (27%)
Similarity:129/331 - (38%) Gaps:93/331 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 HLIG-----AEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGG 105
            |::|     |.:..||...| ||...||:.:                              ||||
Zfish     7 HIVGVALTIALLTGCDAQLD-VCGTAPLNSR------------------------------IVGG 40

  Fly   106 TKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFD 167
            ..|....:|:...:   |:|           .||||:::.:::||||||.           ||..
Zfish    41 QNAPVGAWPWQVSLQRDGSH-----------FCGGSLINNQWILTAAHCF-----------PNPS 83

  Fly   168 SPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY--DTEDEEQGFKNDIALVELDRKAEFNDH 230
            :...:|.||.....|.  ::......|.|.:.||.|  ||||      |||.|::|.....|:::
Zfish    84 TTGLLVYLGLQKLASF--ESYSMSSAVSNIIKHPNYNSDTED------NDITLLQLASTVSFSNY 140

  Fly   231 VAAVCLPPDSGN--DVQQVTAAGWGFTADGV---KSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQ 290
            :..:||......  :...|...|||.||.||   ....|.:|.:....:..|......|..|...
Zfish   141 IRPICLAASDSTFFNGTLVWITGWGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLYGVSKITDNM 205

  Fly   291 FCAGSMSSQADTCNGDSGGP-------IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHL 348
            .|||.:....|:|.||||||       :::|.          ||||:|..|.....|.|||:|..
Zfish   206 VCAGLLQGGKDSCQGDSGGPMVSKQGSVWIQS----------GIVSFGTGCAQPNFPGVYTRVSK 260

  Fly   349 YTDWIE 354
            |..||:
Zfish   261 YQSWIQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/270 (30%)
Tryp_SPc 102..353 CDD:214473 78/267 (29%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 78/298 (26%)
Tryp_SPc 37..267 CDD:238113 80/270 (30%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.