DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and f2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001015797.1 Gene:f2 / 548514 XenbaseID:XB-GENE-481539 Length:607 Species:Xenopus tropicalis


Alignment Length:412 Identity:108/412 - (26%)
Similarity:154/412 - (37%) Gaps:122/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IASVSVVTEYCDN--GTGE---C----KELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPL 68
            |..|.:...||.|  ..||   |    ..||...||            :.|||.         |:
 Frog   246 IKEVKLQENYCRNPDNDGEGLWCYVSHPNLTYDYCP------------MNYCDS---------PI 289

  Fly    69 DHQNL-KPAEQTRPFEKQC----KQYNEVRSACQSTPF----------------------IVGGT 106
            |.:.| :||.:|...|.|.    |.:....:.|...|.                      ||.|.
 Frog   290 DEEVLNRPAGRTTTEEHQTFFDEKSFGSGEAVCGLRPLFEQKSVEDKGEKELLESYMQGRIVKGE 354

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF 171
            .|.....|:..::....|.:..      ||.|::..::||:||||:             |..|  
 Frog   355 TAEPGSAPWQVMLFKKSPQELL------CGASLLSDRWVLSAAHCI-------------FYPP-- 398

  Fly   172 VVRLGELDYNSTTDDALV---QDFR------------VVNYVVHPGYDTEDEEQGFKNDIALVEL 221
                  .|.|.||||.||   :.||            :...:|||.|:.   ::....||||::|
 Frog   399 ------WDKNYTTDDILVRIGKHFRTKYERATERIAQLERIIVHPKYNW---KENLDRDIALIQL 454

  Fly   222 DRKAEFNDHVAAVCLPPDSGNDVQQVTAA-------GWGFTAD----GVKS--SHLLKVNLQRFS 273
            .|...|::::..||||  :.:.|.::.||       |||...:    |.::  ..|.::||....
 Frog   455 KRPVAFSNYIHPVCLP--TKDTVVKLLAAGYKGRVTGWGNLQETWTSGAQNLPQALQQINLPIVD 517

  Fly   274 DEVCQKRLRFSIDTRTQFCAG---SMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG 335
            .|.|:......: |...||||   ..|.:.|.|.||||||..::.|......| :||||:|..|.
 Frog   518 QETCKSSTNIKV-TDNMFCAGYNPEDSKRGDACEGDSGGPFVMKDPDTGRWVQ-LGIVSWGEGCD 580

  Fly   336 SQGLPSVYTKVHLYTDWIESIV 357
            .......|..||....||...|
 Frog   581 RDNKYGFYVHVHRMRKWIMKTV 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/284 (29%)
Tryp_SPc 102..353 CDD:214473 79/281 (28%)
f2NP_001015797.1 GLA 23..86 CDD:214503
KR 106..185 CDD:214527
KR 206..287 CDD:214527 14/52 (27%)
Thrombin_light 303..349 CDD:370463 5/45 (11%)
Tryp_SPc 349..598 CDD:214473 79/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.