DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Hgfac

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006504094.1 Gene:Hgfac / 54426 MGIID:1859281 Length:658 Species:Mus musculus


Alignment Length:300 Identity:89/300 - (29%)
Similarity:133/300 - (44%) Gaps:62/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMA--LIGTHRPNKSKSDINWDCGGS 138
            |...||   .|.:.::.|:..:  |.|:||:.:.....|::|  .||           |..|.||
Mouse   385 APAVRP---TCGKRHKKRTFLR--PRIIGGSSSLPGSHPWLAAIYIG-----------NSFCAGS 433

  Fly   139 VVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY 203
            :||..:|::||||...        .|..||  ..|.||:..:|.|||  :.|.|.:..||.:..|
Mouse   434 LVHTCWVVSAAHCFAN--------SPPRDS--ITVVLGQHFFNRTTD--VTQTFGIEKYVPYTLY 486

  Fly   204 DTEDEEQGFKNDIALVELDRKAE----FNDHVAAVCLPPDSGNDV---QQVTAAGWGFTADGVKS 261
            ...:..   .:|:.|:.|.:|.|    .:..|..:|| |::|:..   .:...||||. .|.::|
Mouse   487 SVFNPN---NHDLVLIRLKKKGERCAVRSQFVQPICL-PEAGSSFPTGHKCQIAGWGH-MDEMQS 546

  Fly   262 S--------HLLKVNLQRFSDEVCQKRLRFSID-TRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317
            |        .||:..:...:|..|.....:..| :....|||....::|.|.||||||:.     
Mouse   547 STDVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLV----- 606

  Fly   318 YPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
              |.|.    :.||:|:|..||....|.|||:|..|.|||
Mouse   607 --CEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWI 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/273 (30%)
Tryp_SPc 102..353 CDD:214473 81/272 (30%)
HgfacXP_006504094.1 FN2 99..145 CDD:128373
EGF_CA 159..194 CDD:238011
FN1 197..237 CDD:238018
EGF_CA 242..275 CDD:238011
Kringle 283..364 CDD:333799
Tryp_SPc 406..646 CDD:238113 82/273 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.