DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and C1s1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001091086.1 Gene:C1s1 / 50908 MGIID:1355312 Length:694 Species:Mus musculus


Alignment Length:325 Identity:91/325 - (28%)
Similarity:132/325 - (40%) Gaps:82/325 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKE 112
            :|.|:..|     |..|.:|           |.||:...:              |.||..|..:.
Mouse   420 LGIELPRC-----IPACGVP-----------TEPFQVHQR--------------IFGGQPAKIEN 454

  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGE 177
            ||:....  :.|..|         |::::..:||||||.||      :..||       ::.:|.
Mouse   455 FPWQVFF--NHPRAS---------GALINEYWVLTAAHVLE------KISDP-------LMYVGT 495

  Fly   178 LDYNST-TDDALVQDFRVVNYVVHPGYDTEDE---EQGFKNDIALVELDRKAEFNDHVAAVCLPP 238
            :...:| .::|  |........:||.:..||:   ...|.||||||:|....:....|:.:|||.
Mouse   496 MSVRTTLLENA--QRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPG 558

  Fly   239 DSG------NDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK--------RLRFSIDTRT 289
            .|.      .|:..:  :|||.|...|...:|....:...|.|.|::        |....:.|..
Mouse   559 TSSEYNVSPGDMGLI--SGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDN 621

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK-QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ..|||...  .|:|:|||||....|.|.....| .|.|:||:|..||:.|   |||||..|.|||
Mouse   622 MICAGEKG--VDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYG---VYTKVKNYVDWI 681

  Fly   354  353
            Mouse   682  681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/271 (30%)
Tryp_SPc 102..353 CDD:214473 80/269 (30%)
C1s1NP_001091086.1 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:373209
CUB 181..293 CDD:366096
CCP 307..361 CDD:153056
CCP 365..428 CDD:153056 3/12 (25%)
Tryp_SPc 443..681 CDD:214473 80/284 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.