DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Prss44

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:323 Identity:94/323 - (29%)
Similarity:137/323 - (42%) Gaps:89/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKPAEQTRPFE-----------------KQCKQYNEVRSAC-QSTPFIVGGTKASGKEFPFMALI 119
            |||.....||:                 :....:....||| ..|..||||..|..:::|:...:
  Rat    66 LKPGGSMTPFDSMGFTPGHSFSSMSLSRQSFPPWIPPTSACGHRTARIVGGKPAPIRKWPWQVSL 130

  Fly   120 GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST- 183
            ..|:.:        .||||::...:|:|||||:             :....:||.:||.|..|: 
  Rat   131 QVHKQH--------ICGGSLISKWWVMTAAHCV-------------YGHLDYVVSMGEADLWSSM 174

  Fly   184 -----TDDALV-QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN 242
                 ..|.:| ||:.|:..:||              |||||.|.....::.::..||:|..|..
  Rat   175 SVKIPVQDIIVHQDYSVMRTIVH--------------DIALVLLAFPVNYSVNIQPVCIPEKSFL 225

  Fly   243 DVQQVT---AAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLR------FSIDTRTQFCAGSMS 297
             ||..|   ..|||.|.:..:||.:|: |:|.....|.|.:.|:      |::......| |...
  Rat   226 -VQPGTLCWVTGWGKTIERGRSSRVLREVDLSIIRHERCNQILKDITGRIFTLVQEGGVC-GYNK 288

  Fly   298 SQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ...|.|.||||||:       :||          :||||:||.||..|.|.:||:|..|.|||
  Rat   289 KGGDACQGDSGGPMVCEFNKTWVQ----------VGIVSWGLGCGRIGYPGIYTEVSYYRDWI 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/276 (31%)
Tryp_SPc 102..353 CDD:214473 83/274 (30%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 83/275 (30%)
Tryp_SPc 113..341 CDD:238113 83/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.