DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012504

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001231011.2 Gene:AgaP_AGAP012504 / 4578496 VectorBaseID:AGAP012504 Length:839 Species:Anopheles gambiae


Alignment Length:260 Identity:88/260 - (33%)
Similarity:126/260 - (48%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSP 169
            |:.|..:||..:|.||....::|   :.|.||||::...|:||||||...|:          :.|
Mosquito    22 GSPAYLREFAHIAAIGWTNEDQS---VRWLCGGSLIWENFILTAAHCAADDD----------NVP 73

  Fly   170 KFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAV 234
            ..|.|:|:::..|..||...|..::|..:.||.:.......    ||||::|:|....:|.||..
Mosquito    74 PDVARMGDINIYSDEDDEFAQQLKIVEIIRHPKHKYNSNYY----DIALMKLERNVTLHDTVAPS 134

  Fly   235 CLPPDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT------QFC 292
            ||..|......::.|||||.|. |...:..||||.|...:::.|....:..:....      |||
Mosquito   135 CLWLDDEIRFPELLAAGWGRTGFDQNTTKTLLKVQLAPITNDKCSTHYQRGVRKLENGLMDHQFC 199

  Fly   293 AGSMSSQADTCNGDSGGP----IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            ||  ..:.|||.||||||    :|.:..|.|.|   :|:.|:|..|| ...|.||.||..:.|||
Mosquito   200 AG--DEKMDTCPGDSGGPLHVKLFKEWKLIPFL---VGVTSFGKACG-LAAPGVYVKVSKFGDWI 258

  Fly   354  353
            Mosquito   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 88/260 (34%)
Tryp_SPc 102..353 CDD:214473 86/258 (33%)
AgaP_AGAP012504XP_001231011.2 Tryp_SPc 22..261 CDD:238113 88/260 (34%)
Tryp_SPc 22..258 CDD:214473 86/258 (33%)
Trypsin 327..528 CDD:278516
Tryp_SPc 333..>433 CDD:304450
Tryp_SPc 611..836 CDD:304450
Tryp_SPc 611..832 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.