DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:276 Identity:80/276 - (28%)
Similarity:123/276 - (44%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RSACQSTPFIVGGTKASGKEFPFMA-LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE 156
            |.|.:|:. ||.|..||..:||:.. |||         |.:..||||::..::|||||||     
Mosquito    36 REATRSSR-IVNGFPASLGQFPYQVFLIG---------DGSLACGGSLISAEWVLTAAHC----- 85

  Fly   157 SKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL 221
                    .....:|.||.|.:..||   ...|:...::  ::||.|:..:    ..|||.|:.|
Mosquito    86 --------QVGISQFTVRAGSIQNNS---GGTVRTSNLI--IIHPNYNPSN----LNNDIGLIRL 133

  Fly   222 DRKAEFNDHVAAVCLPPDSGNDV---QQVTAAGWGFTAD--GVKSSHLLKVNLQRFSDEVCQKRL 281
            :.......::..|.||..:.::.   ::.|.:|:|.|:|  |..|.:|..|:|...|:..|....
Mosquito   134 NEPMPLGGNIQVVALPEANLSETFLNREATVSGFGRTSDASGAISPNLNFVHLNIISNIQCMGTY 198

  Fly   282 RFSIDTRTQFCA-GSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQ- 337
            ..:....:..|| |..:....|||||||||:       .||          ||:||:....|.: 
Mosquito   199 GSATIIDSTVCAVGRDAPNQGTCNGDSGGPLTVTENGQSVQ----------IGVVSFVAAAGCEV 253

  Fly   338 GLPSVYTKVHLYTDWI 353
            |.||.|.:...:.:||
Mosquito   254 GFPSGYVRTTHFRNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/267 (29%)
Tryp_SPc 102..353 CDD:214473 75/265 (28%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 75/267 (28%)
Tryp_SPc 44..272 CDD:238113 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.