DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:280 Identity:73/280 - (26%)
Similarity:110/280 - (39%) Gaps:94/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL-------------ETDESKAERLD 163
            :.|:.||:.|       |...:.|..|::..::|||.|||:             :.||.....|.
Mosquito    15 QLPWTALLKT-------SSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKKDCDEQGVCTLA 72

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
            |                         ||..|...:.|.|:....:    .||||||.|.:...||
Mosquito    73 P-------------------------QDIPVERAIAHDGFSARRK----LNDIALVRLAQNVSFN 108

  Fly   229 DHVAAVCLP--PDSGNDVQQVTAAGWGFTA-DG-----VKSSHLLKVNLQRFSDEVCQKRLRFSI 285
            :.|..:|||  |:     .|...:.: ||| ||     :.:..:....:...:.|.|:.||:..|
Mosquito   109 NDVLPICLPVAPE-----YQPAGSNY-FTARDGQDYASLNTDTISITEVHPLTTENCENRLQELI 167

  Fly   286 DTR-----TQFC---AGSMSSQADTCNGDSGGPIF--------VQHPLYPCLKQVIGIVSYGLV- 333
            ..:     :..|   |||.    |.|...:|||:.        |||          |:||||:. 
Mosquito   168 KRQHKIQESHICGYEAGSF----DGCATSAGGPLVALDRFGRNVQH----------GVVSYGVQD 218

  Fly   334 CGSQGLPSVYTKVHLYTDWI 353
            |..:.:|||||:|..:.:||
Mosquito   219 CSLENVPSVYTRVESFINWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/280 (26%)
Tryp_SPc 102..353 CDD:214473 71/278 (26%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 71/278 (26%)
Tryp_SPc 14..238 CDD:238113 71/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.