DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011040

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001237041.2 Gene:AgaP_AGAP011040 / 4577547 VectorBaseID:AGAP011040 Length:284 Species:Anopheles gambiae


Alignment Length:256 Identity:82/256 - (32%)
Similarity:121/256 - (47%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MALIGTHRPN----KSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            |.|..||...    ..|..|.:.||||::...||||||||::         :||......|||||
Mosquito    26 MRLEHTHAAAIGWLNEKGKIEFGCGGSLILESFVLTAAHCMD---------NPNTLERPLVVRLG 81

  Fly   177 ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSG 241
            :.:...:.|....|:.::.:.:.||.|:.....    .||||:.||:.|.....|...||..:..
Mosquito    82 DRNLIHSKDSEYAQEIKIRDIIPHPKYNRATSH----FDIALLVLDKPARRVFGVIPACLWLEDE 142

  Fly   242 NDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSID--------TRTQFCAGSMS 297
            .....:.|||||... |...:::|:...||..::|.|..:|:..:.        :..|.||..: 
Mosquito   143 LLFSTLYAAGWGANGFDKKPTNYLVTAVLQPVTNEECIDKLKRQVPRMKLANGISDHQLCAAGI- 206

  Fly   298 SQADTCNGDSGGPIFVQ----HPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWI 353
             :.|||.||||||::.:    :.|.|.|   :|:.|||..|| ||  |.||.:|..:.|||
Mosquito   207 -EMDTCKGDSGGPLYSKLNFANKLVPFL---VGLTSYGGPCGFSQ--PGVYVRVSKFRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 82/256 (32%)
Tryp_SPc 102..353 CDD:214473 80/254 (31%)
AgaP_AGAP011040XP_001237041.2 Tryp_SPc 49..264 CDD:238113 76/233 (33%)
Tryp_SPc 49..261 CDD:214473 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.