DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP011430

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001237985.1 Gene:AgaP_AGAP011430 / 4577519 VectorBaseID:AGAP011430 Length:261 Species:Anopheles gambiae


Alignment Length:113 Identity:38/113 - (33%)
Similarity:57/113 - (50%) Gaps:19/113 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TRPFEKQCK--QYNEVRSACQSTPF--IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSV 139
            |:.:::|.|  |.:.:|.....|.|  :.||.:|...||..|.:||..|   :.|.|::.|||::
Mosquito   134 TKYYDEQFKTLQNDSIRMLHDYTGFYGVFGGFRALHDEFQHMVVIGWTR---ASSKIDYLCGGTL 195

  Fly   140 VHPKFVLTAAHCL-ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDD 186
            :..:|||||.||. :.|..:.|           ..|||:.|..||.||
Mosquito   196 ISKQFVLTAVHCAWDGDNLRPE-----------TRRLGDTDLGSTEDD 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 31/86 (36%)
Tryp_SPc 102..353 CDD:214473 31/86 (36%)
AgaP_AGAP011430XP_001237985.1 Tryp_SPc <2..57 CDD:304450
Tryp_SPc 161..>233 CDD:304450 31/86 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.