DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012269

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001238284.2 Gene:AgaP_AGAP012269 / 4577485 VectorBaseID:AGAP012269 Length:649 Species:Anopheles gambiae


Alignment Length:270 Identity:84/270 - (31%)
Similarity:120/270 - (44%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GTKASGKEFPFMALIGTHRPNKSKSD-INWDCGGSVVHPKFVLTAAHC--LETDESKAERLDPNF 166
            |..|....:|:.|.| .||    |.| :::.||||::....:||||||  |........|:.   
Mosquito    44 GIDAKPGHWPWHAAI-FHR----KGDQMDYACGGSIIDENTILTAAHCVFLVNGLLPVSRIS--- 100

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                  |.||.:.....::  .||:..|...:|||||::    ..|.|||||::|......::.|
Mosquito   101 ------VHLGRVHLKEVSE--FVQEHTVQELIVHPGYNS----SRFVNDIALIKLTGSITMSEFV 153

  Fly   232 AAVCL-PPDSGNDV---QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK--RLRFSID-TRT 289
            ..||| ..|...::   :..|..|:|.....|.|..|.:.::.......|.|  ||.|:.. |..
Mosquito   154 QPVCLWTMDKNQELIVGKTGTLVGFGLNEQDVVSEQLKQASIGVVDALTCIKSDRLSFANQLTAE 218

  Fly   290 QFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGIVSYGLVCGSQGL--PSVYT---KVH 347
            .||.|..|: ...|||||||.:|  |:...:     |.|:||:..|....||  ||.||   .|.
Mosquito   219 MFCGGGQSN-VSACNGDSGGGLFFNVEGKWF-----VRGVVSFIPVRQRTGLCDPSKYTAYADVA 277

  Fly   348 LYTDWIESIV 357
            .|..||:..:
Mosquito   278 KYLGWIDQYI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/267 (31%)
Tryp_SPc 102..353 CDD:214473 82/264 (31%)
AgaP_AGAP012269XP_001238284.2 Tryp_SPc 41..285 CDD:238113 84/266 (32%)
Tryp_SPc 43..283 CDD:214473 82/264 (31%)
Tryp_SPc 418..636 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.