DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005587

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001237684.2 Gene:AgaP_AGAP005587 / 4576204 VectorBaseID:AGAP005587 Length:296 Species:Anopheles gambiae


Alignment Length:281 Identity:67/281 - (23%)
Similarity:109/281 - (38%) Gaps:62/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NEVRSACQSTPFIVGGTKASGKEFPFMAL--IGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL 152
            |:||...::......|.:....:||:.||  |....|...:|.| ....||::.|.::||:|..|
Mosquito    51 NQVRIVSETNRLSSDGYEIYAGQFPYHALVYINNENPKPWESSI-VQTAGSLITPNYILTSAEVL 114

  Fly   153 ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ--DFRVVNYVVHPGYDTEDEEQGFKND 215
            .      :.:..|..:..||    ||.|.:..|....|  ||...:..:||.:     ..|...:
Mosquito   115 R------KNILGNGKTYGFV----ELGYRNGADRERQQVIDFTNSSISIHPRF-----SGGLFYN 164

  Fly   216 IALVELDRKAEFNDHVAAVCLPPDSGN---DVQQVTAAG--WGFTADGVKSSHLLKVN--LQRFS 273
            ||.:.|:..|..|.:|..:.||..|.|   ::.:.|:.|  :..|...:::..|...|  ||.: 
Mosquito   165 IATIRLEHPATLNRYVQPIRLPRLSDNRTFEMMEGTSLGHHYNGTMRYMRNQVLPHDNCLLQEY- 228

  Fly   274 DEVCQKRLRFSIDTRTQFCAGSMSSQADTCN---GDSGGPIFVQHPL--YPC-LKQVIGIVSYGL 332
              ||          ...|..|:..::.|...   .|..|||.:...:  |.| |.:         
Mosquito   229 --VC----------TNSFIGGAFCNRVDGAGLTVEDEDGPILIGFTMRVYWCDLNE--------- 272

  Fly   333 VCGSQGLPSVYTKVHLYTDWI 353
                   ..:.|:|.:|.|||
Mosquito   273 -------RDINTRVSVYRDWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 64/269 (24%)
Tryp_SPc 102..353 CDD:214473 62/267 (23%)
AgaP_AGAP005587XP_001237684.2 Tryp_SPc 54..286 CDD:214473 63/276 (23%)
Tryp_SPc 66..289 CDD:304450 64/266 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.