DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:262 Identity:73/262 - (27%)
Similarity:110/262 - (41%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWD--CGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            |:||:..:...  :|..:|      ...:.||.  |||:::..::|||||||:           .
Mosquito    43 IIGGSAVTAPS--WMVAVG------EVVNGNWSNFCGGTLIDKQWVLTAAHCV-----------A 88

  Fly   165 NFDSPKFVVRLGELDYN-----STTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRK 224
            |..|....|.:|..|.:     |..|..|:.....||.:.:.||    .|..:.:|:||:.|...
Mosquito    89 NAQSGPMEVAIGVSDLSRPHTRSKVDQVLMHPEYYVNLLSNLGY----RETPYSSDVALLHLATP 149

  Fly   225 AEFNDHVAAVCLPPDSGN-DVQQVTAAGW-GFTADGVKSS-HLLKVNLQRFSDEVCQKRLRFSID 286
            ......|.|.....|:.. :...:.|.|: |...|..||| .||.|:|....    ::...:...
Mosquito   150 VTQAPIVMADITTKDTWQWNTTMLHAIGYGGINPDATKSSPQLLAVDLAYRG----ERDYWYGDP 210

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTD 351
            |.|...||.::.| |||.||||||:.....|       :|:.|||....:.|....||....::|
Mosquito   211 TTTHIFAGKLAGQ-DTCKGDSGGPLTYGGKL-------VGVTSYGAFPCATGSAGGYTYAPAFSD 267

  Fly   352 WI 353
            ||
Mosquito   268 WI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/262 (28%)
Tryp_SPc 102..353 CDD:214473 71/260 (27%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 71/260 (27%)
Tryp_SPc 43..269 CDD:238113 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.