DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Jon99Fii

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651799.1 Gene:Jon99Fii / 43621 FlyBaseID:FBgn0039777 Length:267 Species:Drosophila melanogaster


Alignment Length:301 Identity:80/301 - (26%)
Similarity:123/301 - (40%) Gaps:71/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSD 130
            ||...|.|.|. ..:..:.|.:..|...:.....|:|||           :...|..        
  Fly    17 IPTPEQKLVPT-PVKDVKIQGRITNGYPAYEGKVPYIVG-----------LLFSGNG-------- 61

  Fly   131 INWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF-----DSPKFVVRLGELDYNSTTDDALVQ 190
             ||.||||::...:|||||||    .:.|..:..|:     :.|::...:|.             
  Fly    62 -NWWCGGSIIGNTWVLTAAHC----TNGASGVTINYGASLRNQPQYTHWVGS------------- 108

  Fly   191 DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ------VTA 249
                .|:|.|..|::.:    ..|||:|:.... .:|...|..|.||  |.||..|      ..|
  Fly   109 ----GNFVQHHHYNSGN----LHNDISLIRTPH-VDFWHLVNKVELP--SYNDRYQDYAGWWAVA 162

  Fly   250 AGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV 313
            :|||.|.||......|: |::|..|...|.:  .:|:.. ...|..:...:: ||.||||||:..
  Fly   163 SGWGGTYDGSPLPDWLQAVDVQIMSQSDCSR--SWSLHD-NMICINTNGGKS-TCGGDSGGPLVT 223

  Fly   314 QHPLYPCLKQVIGIVSYGLVCGSQ-GLPSVYTKVHLYTDWI 353
            ...     .:::|:.|:....|.| |.|:|:::|..|.|||
  Fly   224 HEG-----NRLVGVTSFVSSAGCQSGAPAVFSRVTGYLDWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/265 (27%)
Tryp_SPc 102..353 CDD:214473 70/263 (27%)
Jon99FiiNP_651799.1 Tryp_SPc 37..259 CDD:214473 72/278 (26%)
Tryp_SPc 38..262 CDD:238113 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.