DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG9737

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:421 Identity:126/421 - (29%)
Similarity:178/421 - (42%) Gaps:108/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SVSVVTEYCD--NGT--GECKELTPSDCPVIFYNQ-----HLIGAEVKY-----CD--------- 56
            :::.|.:.||  |.|  |.|.|:  |.|..  |.|     :|...:|.:     |:         
  Fly    20 ALAEVLQECDIPNETKRGVCLEV--SRCKA--YLQVRNATNLPAEKVNFLKKVQCEVEQQVSEAQ 80

  Fly    57 -EFNDIVCCPIPLDHQNLKPAEQTRPFE-----------KQCKQYNEVRSACQSTPF-------- 101
             .:..:||||.. ....|.|..|...||           |:.|....:::...|:.|        
  Fly    81 GSYESLVCCPAN-GQDYLFPVLQFSKFEYRRFLDVTARFKRKKLKRRIQTVEPSSGFNLLNECGK 144

  Fly   102 -----IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAER 161
                 |.||..|...|||::||: .:..|      ::.|.|:::..:.:||||||:: .|...:|
  Fly   145 QVTNRIYGGEIAELDEFPWLALL-VYNSN------DYGCSGALIDDRHILTAAHCVQ-GEGVRDR 201

  Fly   162 LDPNFDSPKFVVRLGEL------------DYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK- 213
            .....      |||||.            :|.|..|.||  |.......|||.|   .|...:| 
  Fly   202 QGLKH------VRLGEFNVKTEPDCIEEPNYLSCADAAL--DIAYEKIHVHPEY---KEFSNYKY 255

  Fly   214 NDIALVELDRKAEFNDHVAAVCLP----PDSGNDVQQVTAAGWGFTAD-------GVKSSHLLKV 267
            ||||::.|.....|...|..:|||    |.:..:.|..:.:|||.| |       .:.|...||:
  Fly   256 NDIAIIRLKHPVSFTHFVMPICLPNKSEPLTLAEGQMFSVSGWGRT-DLFNKYFINIHSPIKLKL 319

  Fly   268 NLQRFSDEVCQKRLR-FSIDT-RTQFCAGSMSSQADTCNGDSGGPIFV---QHPLYPCLKQVIGI 327
            .:...|:|.|.|.|. |.:.. ..|.|||...:: |||.||||||:..   ||..:    ...|:
  Fly   320 RIPYVSNENCTKILEGFGVRLGPKQICAGGEFAK-DTCAGDSGGPLMYFDRQHSRW----VAYGV 379

  Fly   328 VSYGLV-CGSQGLPSVYTKVHLYTDWIESIV 357
            ||||.. ||..|.|:|||.|..|||||:|:|
  Fly   380 VSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 96/283 (34%)
Tryp_SPc 102..353 CDD:214473 94/280 (34%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855 15/64 (23%)
Tryp_SPc 149..406 CDD:214473 94/281 (33%)
Tryp_SPc 150..409 CDD:238113 96/283 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.