DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Jon99Cii

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster


Alignment Length:235 Identity:71/235 - (30%)
Similarity:108/235 - (45%) Gaps:50/235 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDS-----PKFVVRLGELDYNSTTDDALVQD 191
            ||.||||::...:|||||||    .:.|..:..|:.:     |::...:|..|        ::| 
  Fly    60 NWWCGGSIIGNTWVLTAAHC----TNGASGVTINYGASIRTQPQYTHWVGSGD--------IIQ- 111

  Fly   192 FRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQ------VTAA 250
                    |..|::.:    ..|||:|:.... .:|...|..|.||  |.||..|      ..|:
  Fly   112 --------HHHYNSGN----LHNDISLIRTPH-VDFWSLVNKVELP--SYNDRYQDYAGWWAVAS 161

  Fly   251 GWGFTADGVK-SSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ 314
            |||.|.||.. ...|..|::|..|...|.:  .:|:.. ...|..:...:: ||.||||||: |.
  Fly   162 GWGGTYDGSPLPDWLQSVDVQIISQSDCSR--TWSLHD-NMICINTDGGKS-TCGGDSGGPL-VT 221

  Fly   315 HPLYPCLKQVIGIVSYGLVCGSQ-GLPSVYTKVHLYTDWI 353
            |.    ..:::|:.|:|...|.| |.|:|:::|..|.|||
  Fly   222 HD----GNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 71/235 (30%)
Tryp_SPc 102..353 CDD:214473 69/233 (30%)
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 71/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.