DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG11843

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:267 Identity:117/267 - (43%)
Similarity:154/267 - (57%) Gaps:27/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CQS-TPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKA 159
            |:| ||.||||..|..:|||.||.:| .||:.| |..:|.|||.::..:||||||||||::..:.
  Fly    61 CRSYTPLIVGGHPAQPREFPHMARLG-RRPDPS-SRADWFCGGVLISERFVLTAAHCLESERGEV 123

  Fly   160 ERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRK 224
            .           ||||||||::|..:||..:|:.|..|:.||||    |:..|.:||.||:|...
  Fly   124 N-----------VVRLGELDFDSLDEDAAPRDYMVAGYIAHPGY----EDPQFYHDIGLVKLTEA 173

  Fly   225 AEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVK-SSHLLKVNLQRFSDEVCQKRLRFSI--- 285
            ..|:.:....|||...........|.|||.|...:| |:.||||.|||:.:.||:|.|...:   
  Fly   174 VVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKKLLTRQVEEF 238

  Fly   286 ----DTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV 346
                |...|.|.||..:| ||||||||||:.:.|..|||:..|:||.|.||.|||.|:|.:||:|
  Fly   239 PRGFDGNNQLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSPGIPGIYTRV 302

  Fly   347 HLYTDWI 353
            :.|..||
  Fly   303 YPYLGWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 113/260 (43%)
Tryp_SPc 102..353 CDD:214473 111/258 (43%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 113/260 (43%)
Tryp_SPc 68..309 CDD:214473 111/258 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.