DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG11842

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:278 Identity:97/278 - (34%)
Similarity:135/278 - (48%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLE 153
            |..:.......|.|:||..|..||||..|.:|....|   .::.|.|||:::..:.|||||||..
  Fly    60 YKTLDKCTSYAPLIIGGGPAVPKEFPHAARLGHKDEN---GEVEWFCGGTLISDRHVLTAAHCHY 121

  Fly   154 TDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIAL 218
            :.:....           :.|||:|::::..|||..:||.|.::..||    |.......|||::
  Fly   122 SPQGSVN-----------IARLGDLEFDTNNDDADPEDFDVKDFTAHP----EFSYPAIYNDISV 171

  Fly   219 VELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWG--FTADGVKSSHLLKVNLQRFSDEVCQKRL 281
            |.|.|...|||:....|||.|.|.......|.|||  ......::..|.||.|..:.     .|.
  Fly   172 VRLSRPVTFNDYKHPACLPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYG-----TRC 231

  Fly   282 RFSID----------TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGS 336
            |.:.|          ..||.|.|| :...||||||||||:.:.|..|||:..|:||.|.|:.|.:
  Fly   232 RITADRNDELPEGYNATTQLCIGS-NEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDT 295

  Fly   337 QGLPSVYTKVHLYTDWIE 354
            ..||::||:||.|.|||:
  Fly   296 PDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 95/265 (36%)
Tryp_SPc 102..353 CDD:214473 93/262 (35%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 95/265 (36%)
Tryp_SPc 73..312 CDD:214473 93/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 1 1.000 - - FOG0012717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.