DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG5909

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:394 Identity:99/394 - (25%)
Similarity:162/394 - (41%) Gaps:86/394 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLIASVSVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEV--KYCDEFNDI------------ 61
            |:|:..|.||.  ....|:|  :...:||.:.....:.|..:  |..::.:::            
  Fly    18 LVISQSSCVTP--AQAAGQC--IRYQECPFVQKILGIYGRNIPRKIHNQISEMQCRSTTNTRDFH 78

  Fly    62 VCCPIPLDHQNLKPAEQ---------TRPFEKQCKQYNEVRSAC--QSTPFIVGGTKASGKEFPF 115
            :|||.....|:.:.:::         ...:::|..|.....:.|  :..|.:.||..|...:||:
  Fly    79 LCCPNEAPPQSNQESQRKVVRSEGGNLNRYDRQGLQLLNSVTNCGNKGNPKVSGGKTARPGDFPW 143

  Fly   116 MALIGTHRPNKSKSDIN----WDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFV-VRL 175
            :||:        |..||    :.||||::..:.:||||||:             .|.|:.: |||
  Fly   144 VALL--------KYKINDPRPFRCGGSLISERHILTAAHCI-------------IDQPEVIAVRL 187

  Fly   176 GELDYNSTTDDALV-----------QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
            ||.|..|..|...:           :::.:....|||.|    ......:|:|:::|||..:...
  Fly   188 GEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNY----VHGKISHDVAIIKLDRVVKEKS 248

  Fly   230 HVAAVCLPPDSGNDV----QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQ 290
            |:..||||.|..:..    |....||||.|.....::.|.:..:.|.|...|::.......:...
  Fly   249 HIKPVCLPIDQKSQELDFDQSFFVAGWGGTEKETVATKLQQALITRKSLNECRQYYNKGEVSDNH 313

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV------CGSQGLPSVYTKVHLY 349
            .||.....: .||.||||||:|.:|.    .|....:|.||:|      || |..|.|:..|...
  Fly   314 ICATGTGIK-HTCQGDSGGPVFFKHR----FKNTYRVVQYGVVSFGGRLCG-QNQPGVFASVIDM 372

  Fly   350 TDWI 353
            ..||
  Fly   373 LPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/278 (29%)
Tryp_SPc 102..353 CDD:214473 78/276 (28%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829 9/60 (15%)
Tryp_SPc 129..376 CDD:214473 78/277 (28%)
Tryp_SPc 132..379 CDD:238113 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.