DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and grass

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:407 Identity:109/407 - (26%)
Similarity:167/407 - (41%) Gaps:91/407 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPGIQILLLIASVSVVTEYCDNGT------GEC----------KELT---------PSDCPVIFY 43
            |.||.|:..:...|...:|.|:.|      |:|          :.||         |:|     |
  Fly    10 LYGIAIVSSMGVQSARADYADDCTTPDGDQGQCMPFSSCRTIEERLTEAQKAGQKVPAD-----Y 69

  Fly    44 NQHLIGAEVKYCDEFNDI--VCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGT 106
            ..:|   :...|.|||.:  .|||......|.|.....:.....|..:...|        :..|.
  Fly    70 ASYL---QKALCGEFNGVRHFCCPSANIQHNSKVMSLFKDENFDCGNFLSQR--------VSNGY 123

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF 171
            :......|:|||:...:..:|:    :.|||:::..:::||||||:.           ...:..:
  Fly   124 EVKLSSRPWMALLRYQQFGESR----FLCGGAMISERYILTAAHCVH-----------GLQNDLY 173

  Fly   172 VVRLGELDYNSTTDDALVQDFR-------VVN-----YVVHPGYDTEDEEQGFKNDIALVELDRK 224
            .:||||  :..:|::...|..|       |||     :::|..||.    :...:||||::|:|.
  Fly   174 EIRLGE--HRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDA----RHIMHDIALLKLNRS 232

  Fly   225 AEFNDHVAAVCLP-----PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFS 284
            ..|..|:..:|||     .:....:......|||.|.:|..|..||:.|:.......|.:..|.:
  Fly   233 VPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTENGSSSDVLLQANVPLQPRSACSQAYRRA 297

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL-----YPCLKQVIGIVSYGLV-CGSQGLPSVY 343
            :.. :|.|.|....| |:|.||||||:  |.|.     |.......||||.|:| ||...||.:|
  Fly   298 VPL-SQLCVGGGDLQ-DSCKGDSGGPL--QAPAQYLGEYAPKMVEFGIVSQGVVTCGQISLPGLY 358

  Fly   344 TKVHLYTDWIESIVWGN 360
            |.|..|..||...:..|
  Fly   359 TNVGEYVQWITDTMASN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/276 (29%)
Tryp_SPc 102..353 CDD:214473 79/273 (29%)
grassNP_651543.1 CLIP 32..90 CDD:197829 14/65 (22%)
Tryp_SPc 121..371 CDD:238113 81/274 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.