DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and SPE

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:383 Identity:119/383 - (31%)
Similarity:169/383 - (44%) Gaps:87/383 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GECKELTPSDCPVIFYNQHLIGAEVK-----------YCDEFNDI--------VCCPIPLDHQNL 73
            |:|..:|  .||   |..:|:..|.|           .|...|.:        ||||..: ..|:
  Fly    44 GQCVHIT--SCP---YLANLLMVEPKTPAQRILLSKSQCGLDNRVEGLVNRILVCCPQSM-RGNI 102

  Fly    74 KPAEQTRPFEKQCKQYNEVRSACQSTPF-----IVGGTKASGKEFPFMALIGTHRPNKSKSD-IN 132
            ..:|.| |..:...|..:|........|     |.|||..:..|||:|.|:   :..|..|: ..
  Fly   103 MDSEPT-PSTRDALQQGDVLPGNDVCGFLFADRIFGGTNTTLWEFPWMVLL---QYKKLFSETYT 163

  Fly   133 WDCGGSVVHPKFVLTAAHCL---ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ---- 190
            ::|||::::.::||||.|||   |.|:|.|         ....|||||.| ..|..|...|    
  Fly   164 FNCGGALLNSRYVLTAGHCLASRELDKSGA---------VLHSVRLGEWD-TRTDPDCTTQMNGQ 218

  Fly   191 --------DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS------- 240
                    |..|...::|..|.....:|  :||||||.|.|...:.|:|..:|||.|.       
  Fly   219 RICAPKHIDIEVEKGIIHEMYAPNSVDQ--RNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFV 281

  Fly   241 --GNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKR---LRFSIDTRTQFCAGSMSSQA 300
              |.||     ||||.|.:...|:..||:.:..::...||::   .:..:|. :|.|||.... .
  Fly   282 DYGMDV-----AGWGLTENMQPSAIKLKITVNVWNLTSCQEKYSSFKVKLDD-SQMCAGGQLG-V 339

  Fly   301 DTCNGDSGGPIFVQHPLYPCLKQVI---GIVSYGL-VCGSQGLPSVYTKVHLYTDWIE 354
            |||.||||||:.|  |:....:.|.   |:.|||. .||.:|.|.|||:...:.|||:
  Fly   340 DTCGGDSGGPLMV--PISTGGRDVFYIAGVTSYGTKPCGLKGWPGVYTRTGAFIDWIK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 97/285 (34%)
Tryp_SPc 102..353 CDD:214473 95/282 (34%)
SPENP_651168.1 CLIP 42..94 CDD:314844 12/54 (22%)
Tryp_SPc 135..397 CDD:238113 97/285 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.