DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG16710

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:411 Identity:111/411 - (27%)
Similarity:162/411 - (39%) Gaps:123/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QILLLIASVSVVTEY--CD-----NGTGECKELTPSDCPVIFYNQHLIGA------EVKYC---- 55
            |:|:.:|.    :||  |:     .....|..|.|      |...|.:..      |.:||    
  Fly    17 QLLMYLAE----SEYPPCNLDEKCISLARCTSLLP------FLKPHNMTPAEKAVFEDRYCGYGP 71

  Fly    56 --DEFND--IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFM 116
              .|..|  ::|||   :..::.|..|.      |   ..:..|.:    |.||.:....|.|:|
  Fly    72 KGQELLDRVLICCP---NMGHILPNTQI------C---GPIMPAYR----IFGGEETQPNELPWM 120

  Fly   117 ALI-GTHRPNKSKSDINWD------CGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVR 174
            ||| ..||   |:|  .|:      |.||::..::||||||||........|           ||
  Fly   121 ALILYAHR---SRS--VWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRR-----------VR 169

  Fly   175 LGELDYNSTTD-------------DALVQD----FRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
            |||.:..|..|             :.|..|    .:..:|:|.       ||:.: |||||:.|.
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVF-------EERPY-NDIALLRLK 226

  Fly   223 RKAEFNDHVAAVCLP-------PDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQ-RFSDEVCQK 279
            ....:...:..:|:.       |...|...|:  ||||.:.....|:.||:..:. |.:||....
  Fly   227 FPVRYTAQIKPICVQLDYIFSNPSFSNHKLQI--AGWGLSHKQGYSNVLLQAYVNGRNADECSLS 289

  Fly   280 RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV------QHPLYPCLKQVIGIVSYGL-VCGSQ 337
            .....:|..|..|||::... |||.||||||:..      :..:|     :.||.|||. .||..
  Fly   290 EPSLGLDKETHICAGNLGGN-DTCKGDSGGPLMAIMERGDEEFVY-----LAGITSYGYSQCGYG 348

  Fly   338 GLPSVYTKVHLYTDWIESIVW 358
              |:.|||...:.:|   |:|
  Fly   349 --PAAYTKTSKFVEW---ILW 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/292 (29%)
Tryp_SPc 102..353 CDD:214473 85/289 (29%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 10/54 (19%)
Tryp_SPc 105..362 CDD:214473 86/297 (29%)
Tryp_SPc 106..362 CDD:238113 86/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.