DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG7432

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:413 Identity:113/413 - (27%)
Similarity:162/413 - (39%) Gaps:106/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VTEYCDNGT---GECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPI-------------- 66
            |..||...:   |.|::|  |.||.:..|...:...:.:...:...|||||              
  Fly   331 VENYCKTPSGRRGRCEDL--SSCPALLLNLSSLRESLCFKSLYVPGVCCPISSSSTVLTTQKPLR 393

  Fly    67 ----------------PLDHQNLKPAEQTRPFE-------------------------------- 83
                            |.....::|.  |||..                                
  Fly   394 LTTRPTTTTSTTKATQPTKKSTVRPT--TRPTSGLVLIPQKKPPTTTTTTTTEVPLEPEGLDEIG 456

  Fly    84 ------KQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHP 142
                  .:|.|..      .||..||||.:|...::|:||.|..|.|.:::.   | ||||::..
  Fly   457 NNIVDPDECGQQE------YSTGRIVGGVEAPNGQWPWMAAIFLHGPKRTEF---W-CGGSLIGT 511

  Fly   143 KFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTED 207
            |::||||||......|.      |.:.:|.||||::|.::..:.:....|.|.....|..:    
  Fly   512 KYILTAAHCTRDSRQKP------FAARQFTVRLGDIDLSTDAEPSDPVTFAVKEVRTHERF---- 566

  Fly   208 EEQGFKNDIALVELDRKAEFNDHVAAVCL------PPDSGNDVQQVTAAGWGFTADGVK-SSHLL 265
            ...||.||||::.||:....:.:|..|||      ||......::.|..|||.|..|.| |:...
  Fly   567 SRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVGWGTTYYGGKESTSQR 631

  Fly   266 KVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY 330
            :..|..:.:|.|. |..|........|||......|.|.||||||:.::   |......:|:||:
  Fly   632 QAELPIWRNEDCD-RSYFQPINENFICAGYSDGGVDACQGDSGGPLMMR---YDSHWVQLGVVSF 692

  Fly   331 GLVCGSQGLPSVYTKVHLYTDWI 353
            |..||..|.|.|||:|..|.|||
  Fly   693 GNKCGEPGYPGVYTRVTEYLDWI 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 89/259 (34%)
Tryp_SPc 102..353 CDD:214473 87/257 (34%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 10/44 (23%)
Tryp_SPc 474..715 CDD:214473 87/258 (34%)
Tryp_SPc 475..718 CDD:238113 89/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.