DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG31219

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:321 Identity:88/321 - (27%)
Similarity:142/321 - (44%) Gaps:59/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTH 122
            |...:|||.|   .|..|:             .|:.....||..:|||::|....:|:||::  .
  Fly    61 FGQRICCPPP---GNRLPS-------------TEICGQSLSTYRMVGGSEARPNGYPWMAML--L 107

  Fly   123 RPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFV----VRLGELD---- 179
            ..|.:..:|...|.||:::.::|||:|||:.             ..|:.:    |||||.|    
  Fly   108 YLNTTTLEILPFCAGSLINNRYVLTSAHCVN-------------GIPRDLSLKSVRLGEHDITYD 159

  Fly   180 --YNSTTDDALVQ------DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL 236
              ||....|...|      :.::...:|| |..:....:..:.||||:.|.....:...:..:|:
  Fly   160 PAYNPDCRDQDNQCALPNLEIKLEKIIVH-GLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICI 223

  Fly   237 PPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRF-SIDTRTQFCAGSMSSQA 300
            |........::..||||.|.:|..|..|:...::..|..||..|..: .::...|.|||.... .
  Fly   224 PKHGFFAKSKLEIAGWGKTNEGQFSQVLMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDG-V 287

  Fly   301 DTCNGDSGGPIFV---QHPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTKVHLYTDWIESIV 357
            |||.||||||:.|   ...:|     :.||.:||.. ||..|:|.:||:...:..||::::
  Fly   288 DTCQGDSGGPLMVTMDNSSVY-----LAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/274 (28%)
Tryp_SPc 102..353 CDD:214473 76/271 (28%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 76/272 (28%)
Tryp_SPc 90..342 CDD:238113 78/273 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.