DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG5246

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:273 Identity:74/273 - (27%)
Similarity:119/273 - (43%) Gaps:66/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF----MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            ::||..:.....|:    |...|.|           .||||::.|:::||||||:|         
  Fly    42 VIGGVDSPTGFAPYQVSIMNTFGEH-----------VCGGSIIAPQWILTAAHCME--------- 86

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
               :......:..|.:||.....:.||...:     :|..:|    :..:.|||||:...:...:
  Fly    87 ---WPIQYLKIVTGTVDYTRPGAEYLVDGSK-----IHCSHD----KPAYHNDIALIHTAKPIVY 139

  Fly   228 NDHVAAVCLP-----PDSGNDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRLRFS-- 284
            :|....:.|.     |..|:   ::|..|||.|.. |..|:.|.|::|.....:.||.|:|.:  
  Fly   140 DDLTQPIKLASKGSLPKVGD---KLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANW 201

  Fly   285 -----IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT 344
                 :.|.||...||       |:|||||      ||....:.::|:|::|..| :.|.|.|:.
  Fly   202 LSEGHVCTFTQEGEGS-------CHGDSGG------PLVDANQTLVGVVNWGEAC-AIGYPDVFG 252

  Fly   345 KVHLYTDWIESIV 357
            .|..|.||||.::
  Fly   253 SVAYYHDWIEQMM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/270 (27%)
Tryp_SPc 102..353 CDD:214473 71/267 (27%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 71/267 (27%)
Tryp_SPc 42..263 CDD:238113 73/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.