DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG17475

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:283 Identity:75/283 - (26%)
Similarity:121/283 - (42%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTH-RPNKSKSDINWD-------CGGSVVHPK 143
            |..:.||.|..|...:...:||.|..|....:.|.. :..::|..|:..       |||.::..:
  Fly    20 KPISAVRLAQLSEDQLEWISKAEGVNFQNRVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDER 84

  Fly   144 FVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDE 208
            .|||||||:.           .::.....|..|.::|..  .||:   :.|..:.:|..|::.| 
  Fly    85 HVLTAAHCVY-----------GYNPTYLRVITGTVEYEK--PDAV---YFVEEHWIHCNYNSPD- 132

  Fly   209 EQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFT-ADGVKSSHLLKVNLQRF 272
               :.|||||:.|:...:||::.....||.....:..|:...|||.| ..|.....|.|..|...
  Fly   133 ---YHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHV 194

  Fly   273 SDEVCQKRLRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGS 336
            ....||:.:... .:.....|..:...|. .|:||||||:.....||       |:|::|..| :
  Fly   195 VYSTCQEIMNNDPSNGPCHICTLTTGGQG-ACHGDSGGPLTHNGVLY-------GLVNWGYPC-A 250

  Fly   337 QGLPSVYTKVHLYTDWIESIVWG 359
            .|:|..:..|:.|.:||.|::.|
  Fly   251 LGVPDSHANVYYYLEWIRSMISG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 68/263 (26%)
Tryp_SPc 102..353 CDD:214473 66/260 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 62/246 (25%)
Tryp_SPc 50..269 CDD:238113 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.