DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Sb

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:329 Identity:90/329 - (27%)
Similarity:138/329 - (41%) Gaps:82/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 EFNDIVCCPIP----LDHQNLKPAEQTRPFEKQCKQYNEVRSAC------QSTPFIVGGTKASGK 111
            |.|:|....||    |.|               .|..:..||.|      :....||||..|:..
  Fly   504 ETNEISDSSIPDAGALGH---------------VKTISAARSECGVPTLARPETRIVGGKSAAFG 553

  Fly   112 EFP---------FMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFD 167
            .:|         |.....|||           |||::::..::.||.||:  |:....::.    
  Fly   554 RWPWQVSVRRTSFFGFSSTHR-----------CGGALINENWIATAGHCV--DDLLISQIR---- 601

  Fly   168 SPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVA 232
                 :|:||.|::...:.....:..|...||||.|..    ..::.|:|||:|::..||..||:
  Fly   602 -----IRVGEYDFSHVQEQLPYIERGVAKKVVHPKYSF----LTYEYDLALVKLEQPLEFAPHVS 657

  Fly   233 AVCLP-PDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQF---- 291
            .:||| .||.......|..||| .:..|...|.|.:|::...|::.|:.  .|....|.:|    
  Fly   658 PICLPETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKS--MFMRAGRQEFIPDI 720

  Fly   292 --CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQGLPSVYTKVHLY 349
              |||..:...|:|.||||||:..:       .|     :.||:|:|:.|....||.|.|::..:
  Fly   721 FLCAGYETGGQDSCQGDSGGPLQAK-------SQDGRFFLAGIISWGIGCAEANLPGVCTRISKF 778

  Fly   350 TDWI 353
            |.||
  Fly   779 TPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/274 (29%)
Tryp_SPc 102..353 CDD:214473 77/272 (28%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 77/273 (28%)
Tryp_SPc 544..785 CDD:238113 79/274 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.