DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and ea

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:336 Identity:108/336 - (32%)
Similarity:143/336 - (42%) Gaps:70/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IVCCPIPLDHQNLKPAEQT------------RPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEF 113
            ::|||   |......:|.|            .|...||......|        |.||.|....||
  Fly    86 LICCP---DRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILSNR--------IYGGMKTKIDEF 139

  Fly   114 PFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGEL 178
            |:||||   ...||:......||||::..::|:||:||:   ..||...|.....    |||||.
  Fly   140 PWMALI---EYTKSQGKKGHHCGGSLISTRYVITASHCV---NGKALPTDWRLSG----VRLGEW 194

  Fly   179 DYNSTTDDALVQ------------DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
            |.| |..|..|.            |..|...:.||.|....:.|  .|||||:.|.::.|:.|.|
  Fly   195 DTN-TNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQ--VNDIALLRLAQQVEYTDFV 256

  Fly   232 AAVCLPPD-----SGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSID---TR 288
            ..:|||.|     :..|...:..||||.|.....|:..||..::.|..:.|| .:..|.|   ..
  Fly   257 RPICLPLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDECQ-NVYSSQDILLED 320

  Fly   289 TQFCAGSMSSQADTCNGDSGGPIF------VQHPLYPCLKQVIGIVSYG-LVCGSQGLPSVYTKV 346
            ||.|||.... .|:|.||||||:.      |....:     :.|:||:| ..||..|.|.|||.|
  Fly   321 TQMCAGGKEG-VDSCRGDSGGPLIGLDTNKVNTYYF-----LAGVVSFGPTPCGLAGWPGVYTLV 379

  Fly   347 HLYTDWIESIV 357
            ..|.|||::.:
  Fly   380 GKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 98/280 (35%)
Tryp_SPc 102..353 CDD:214473 96/277 (35%)
eaNP_524362.2 CLIP 37..89 CDD:288855 0/2 (0%)
Tryp_SPc 127..386 CDD:214473 97/286 (34%)
Tryp_SPc 128..389 CDD:238113 98/280 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.