DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CG9631

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:276 Identity:68/276 - (24%)
Similarity:113/276 - (40%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 TPFIVGGTKASGKEFPFMAL----IGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKA 159
            :|..:||...:..::|::|.    :||         ..:.|..||:..:.|:|||||:....:. 
  Fly   194 SPLQIGGDLVTRGQYPWLAALYEGVGT---------ATYKCVVSVISKRTVITAAHCIYGKSAS- 248

  Fly   160 ERLDPNFDSPKFVVRLGELDYNSTTDD--ALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELD 222
                      :..|.||..|.|...::  :||....|:....:.|....|.      |:.|:.|.
  Fly   249 ----------QLWVYLGRHDRNENPENGASLVSVTSVLTPSAYEGNPVPDA------DVGLLVLT 297

  Fly   223 RKAEFNDHVAAVC-------LPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKR 280
            ....:..::..:|       |||:.| |...|  ||||:.....|:.....|:::....:.|.|.
  Fly   298 SPMVYTKYIRPLCLWGSNMGLPPNEG-DTGAV--AGWGYDRSAQKTRFPKTVSVRLVPRDQCLKE 359

  Fly   281 LRFSID--TRTQFCAGSMSSQADTCNGDSGGPIFV--QHPLYPCLKQVIGIVS----YGLVCGSQ 337
            ::.:.|  ||...|||:..|.. .|.||||..:.|  .:..|     |.|:||    :|.:|...
  Fly   360 MKRAEDFITRRTVCAGNSESHG-PCFGDSGSALIVLRNNRWY-----VRGVVSLSPRHGEICDLS 418

  Fly   338 GLPSVYTKVHLYTDWI 353
            .. .:|..|..:.||:
  Fly   419 KY-VIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 67/273 (25%)
Tryp_SPc 102..353 CDD:214473 66/271 (24%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 67/272 (25%)
Tryp_SPc 198..433 CDD:214473 66/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.